PDB entry 1u3m

View 1u3m on RCSB PDB site
Description: NMR structure of the chicken prion protein fragment 128-242
Class: membrane protein
Keywords: prion protein, tse, prp, membrane protein
Deposited on 2004-07-22, released 2005-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: prion-like protein
  Species: Gallus gallus [TaxId:9031]
  Gene: PRNP
  Database cross-references and differences (RAF-indexed):
  • Uniprot P27177 (2-116)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d1u3ma1, d1u3ma2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u3mA (A:)
  gsvvgglggyamgrvmsgmnyhfdrpdeyrwwsensarypnrvyyrdysspvpqdvfvad
  cfnitvteysigpaakkntseavaaanqtevemenkvvtkviremcvqqyreyrlas