PDB entry 1u3l

View 1u3l on RCSB PDB site
Description: ispf with mg and cdp
Deposited on 2004-07-22, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.24
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1u3la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u3lA (A:)
    mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
    fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
    gchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3lA (A:)
    mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
    fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
    gchmddvnvkattteklgftgrgegiaceavalli