PDB entry 1u3l

View 1u3l on RCSB PDB site
Description: IspF with Mg and CDP
Class: lyase
Keywords: lyase, MEP pathway, terpene biosynthesis
Deposited on 2004-07-22, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Escherichia coli [TaxId:562]
    Gene: ISPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u3la_
  • Heterogens: MG, ZN, CDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u3lA (A:)
    mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
    fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
    gchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3lA (A:)
    mrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigkl
    fpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaedl
    gchmddvnvkattteklgftgrgegiaceavalli