PDB entry 1u3h

View 1u3h on RCSB PDB site
Description: Crystal structure of mouse TCR 172.10 complexed with MHC class II I-Au molecule at 2.4 A
Class: immune system
Keywords: complex, IMMUNE SYSTEM
Deposited on 2004-07-21, released 2005-05-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.232
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor alpha-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1u3ha1
  • Chain 'B':
    Compound: Mouse TCRVbeta 172.10, extracellular variable domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1u3hb1
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, A-U alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Aa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14438 (3-181)
      • cloning artifact (0-2)
    Domains in SCOPe 2.05: d1u3hc1, d1u3hc2
  • Chain 'D':
    Compound: H-2 class II histocompatibility antigen, A-U beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1u3hd1, d1u3hd2
  • Chain 'E':
    Compound: T-cell receptor alpha-chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1u3he_
  • Chain 'F':
    Compound: Mouse TCRVbeta 172.10, extracellular variable domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1u3hf_
  • Chain 'G':
    Compound: H-2 class II histocompatibility antigen, A-U alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-Aa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14438 (3-181)
      • cloning artifact (0-2)
    Domains in SCOPe 2.05: d1u3hg1, d1u3hg2
  • Chain 'H':
    Compound: H-2 class II histocompatibility antigen, A-U beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1u3hh1, d1u3hh2
  • Chain 'I':
    Compound: Myelin basic protein (MBP)-peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1U3H (0-11)
  • Chain 'P':
    Compound: Myelin basic protein (MBP)-peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1U3H (0-11)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3hA (A:)
    qvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgrf
    tiffnkrekklslhiadsqpgdsatyfcaasansgtyqrfgtgtklqvvp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3hB (B:)
    avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghglrliyysygagstekgdipd
    gykasrpsqenfsltlesatpsqtsvyfcasgdagggyeqyfgpgtrltvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3hC (C:)
    ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
    lqniatgkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3hD (D:)
    gdserhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaey
    ynkqylertraeldtvcrynyeetevptslrrleqpnvvislsrtealnhhntlvcsvtd
    fypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslk
    spitvewra
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3hE (E:)
    qvrqspqsltvwegetailncsyensafdyfpwyqqfpgegpallisilsvsdkkedgrf
    tiffnkrekklslhiadsqpgdsatyfcaasansgtyqrfgtgtklqvvp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3hF (F:)
    avtqsprnkvavtgekvtlscnqtnnhnnmywyrqdtghglrliyysygagstekgdipd
    gykasrpsqenfsltlesatpsqtsvyfcasgdagggyeqyfgpgtrltvl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3hG (G:)
    ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
    lqniatgkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3hH (H:)
    gdserhfvvqfqpfcyftngtqriryvtryiynreeylrfdsdvgeyravtelgrpdaey
    ynkqylertraeldtvcrynyeetevptslrrleqpnvvislsrtealnhhntlvcsvtd
    fypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslk
    spitvewra
    

  • Chain 'I':
    No sequence available.

  • Chain 'P':
    No sequence available.