PDB entry 1u3g

View 1u3g on RCSB PDB site
Description: Structural and Functional Characterization of a 5,10-Methenyltetrahydrofolate Synthetase from Mycoplasma pneumoniae (GI: 13508087)
Class: ligase
Keywords: Mycoplasma pneumoniae; 5,10-methenyltetrahydrofolate synthetase; 5-formyltetrahydrofolate cyclo-ligase; MTHFS; ATP binding; ligase; Structural Genomics; BSGC structure funded by NIH; Protein Structure Initiative; PSI; Berkeley Structural Genomics Center
Deposited on 2004-07-21, released 2004-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 2004-12-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 5,10-methenyltetrahydrofolate synthetase
  Species: Mycoplasma pneumoniae
  Database cross-references and differences (RAF-indexed):
  • Uniprot P75430 (25-188)
  Domains in SCOP 1.75: d1u3ga_
• Heterogens: PO4, MG, ADP, THF, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1u3gA (A:)
  mgsshhhhhhdydipttenlyfqghmdknalrkqilqkrmalstiekshldqkinqklva
  fltpkpciktialyepiknevtfvdfffeflkinqiravypkvisdteiifidqetntfe
  pnqidcfliplvgfnkdnyrlgfgkgyydrylmqltrqqpkigiaysfqkgdfladpwdv
  qldliinde
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1u3gA (A:)
  mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvd
  fffeflkinqiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgk
  gyydrylmqltrqqpkigiaysfqkgdfladpwdvqldliinde