PDB entry 1u3f

View 1u3f on RCSB PDB site
Description: Structural and Functional Characterization of a 5,10-Methenyltetrahydrofolate Synthetase from Mycoplasma pneumoniae (GI: 13508087)
Class: ligase
Keywords: Mycoplasma pneumoniae; 5, 10-methenyltetrahydrofolate synthetase; 5-formyltetrahydrofolate cyclo-ligase; MTHFS; ATP binding; ligase; Structural Genomics; BSGC structure funded by NIH; Protein Structure Initiative; PSI; Berkeley Structural Genomics Center, PSI, Protein Structure Initiative
Deposited on 2004-07-21, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.223
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-methenyltetrahydrofolate synthetase
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u3fa_
  • Chain 'B':
    Compound: 5,10-methenyltetrahydrofolate synthetase
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u3fb_
  • Heterogens: PO4, MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u3fA (A:)
    mgsshhhhhhdydipttenlyfqghmdknalrkqilqkrmalstiekshldqkinqklva
    fltpkpciktialyepiknevtfvdfffeflkinqiravypkvisdteiifidqetntfe
    pnqidcfliplvgfnkdnyrlgfgkgyydrylmqltrqqpkigiaysfqkgdfladpwdv
    qldliinde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3fA (A:)
    mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvd
    fffeflkinqiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgk
    gyydrylmqltrqqpkigiaysfqkgdfladpwdvqldliinde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u3fB (B:)
    mgsshhhhhhdydipttenlyfqghmdknalrkqilqkrmalstiekshldqkinqklva
    fltpkpciktialyepiknevtfvdfffeflkinqiravypkvisdteiifidqetntfe
    pnqidcfliplvgfnkdnyrlgfgkgyydrylmqltrqqpkigiaysfqkgdfladpwdv
    qldliinde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3fB (B:)
    mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvd
    fffeflkinqiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgk
    gyydrylmqltrqqpkigiaysfqkgdfladpwdvqldliinde