PDB entry 1u3e

View 1u3e on RCSB PDB site
Description: DNA binding and cleavage by the HNH homing endonuclease I-HmuI
Class: DNA binding protein/DNA
Keywords: HNH catalytic motif, Helix-turn-helix DNA binding domain, protein-DNA complex, DNA binding protein-DNA COMPLEX
Deposited on 2004-07-21, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.216
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 36-mer
  • Chain 'B':
    Compound: 5'-d(*cp*tp*tp*ap*cp*gp*tp*gp*gp*gp*ap*ap*tp*tp*gp*cp*tp*gp*ap*gp*c)-3'
  • Chain 'C':
    Compound: 5'-d(p*gp*tp*tp*ap*gp*gp*cp*tp*cp*ap*tp*tp*ap*cp*t)-3'
  • Chain 'M':
    Compound: HNH homing endonuclease
    Species: Bacillus phage SPO1 [TaxId:10685]
    Gene: bacteriophage SP01
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u3em1, d1u3em2
  • Heterogens: MN, SR, EDO, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u3eM (M:)
    mewkdikgyeghyqvsntgevysiksgktlkhqipkdgyhriglfkggkgktfqvhrlva
    ihfcegyeeglvvdhkdgnkdnnlstnlrwvtqkinvenqmsrgtlnvskaqqiakiknq
    kpiivispdgiekeypstkcaceelgltrgkvtdvlkghrihhkgytfryklng