PDB entry 1u3d

View 1u3d on RCSB PDB site
Description: Crystal Structure of the PHR domain of Cryptochrome 1 from Arabidopsis thaliana with AMPPNP bound
Class: signaling protein
Keywords: photolyase, AMPPNP, SIGNALING PROTEIN
Deposited on 2004-07-21, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.204
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cryptochrome 1 apoprotein
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u3da1, d1u3da2
  • Heterogens: MG, CL, FAD, ANP, NDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u3dA (A:)
    msgsvsgcgsggcsivwfrrdlrvednpalaaavragpvialfvwapeeeghyhpgrvsr
    wwlknslaqldsslrslgtclitkrstdsvaslldvvkstgasqiffnhlydplslvrdh
    rakdvltaqgiavrsfnadllyepwevtdelgrpfsmfaafwerclsmpydpespllppk
    kiisgdvskcvadplvfeddsekgsnallarawspgwsngdkalttfingplleysknrr
    kadsattsflsphlhfgevsvrkvfhlvrikqvawanegneageesvnlflksiglreys
    ryisfnhpysherpllghlkffpwavdenyfkawrqgrtgyplvdagmrelwatgwlhdr
    irvvvssffvkvlqlpwrwgmkyfwdtlldadlesdalgwqyitgtlpdsrefdridnpq
    fegykfdpngeyvrrwlpelsrlptdwihhpwnapesvlqaagielgsnyplpivgldea
    karlhealsqmwqleaasraaiengseeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3dA (A:)
    csivwfrrdlrvednpalaaavragpvialfvwapeeeghyhpgrvsrwwlknslaqlds
    slrslgtclitkrstdsvaslldvvkstgasqiffnhlydplslvrdhrakdvltaqgia
    vrsfnadllyepwevtdelgrpfsmfaafwerclsmpydpespllppkkiisgdvskcva
    dplvfeddsekgsnallarawspgwsngdkalttfingplleysknrrkadsattsflsp
    hlhfgevsvrkvfhlvrikqvawanegneageesvnlflksiglreysryisfnhpyshe
    rpllghlkffpwavdenyfkawrqgrtgyplvdagmrelwatgwlhdrirvvvssffvkv
    lqlpwrwgmkyfwdtlldadlesdalgwqyitgtlpdsrefdridnpqfegykfdpngey
    vrrwlpelsrlptdwihhpwnapesvlqaagielgsnyplpivgldeakarlhealsqmw
    qleaa