PDB entry 1u3a

View 1u3a on RCSB PDB site
Description: mutant DsbA
Class: oxidoreductase
Keywords: thiol oxidoreductase, thiol disulfide interchange, thioredoxin
Deposited on 2004-07-21, released 2005-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiol: disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:562]
    Gene: dsbA; ppfA, dsf;
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (32)
    Domains in SCOPe 2.07: d1u3aa_
  • Chain 'B':
    Compound: Thiol: disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:562]
    Gene: dsbA; ppfA, dsf;
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (32)
    Domains in SCOPe 2.07: d1u3ab_
  • Chain 'D':
    Compound: Thiol: disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:562]
    Gene: dsbA; ppfA, dsf;
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991
      • engineered (32)
    Domains in SCOPe 2.07: d1u3ad_
  • Chain 'E':
    Compound: Thiol: disulfide interchange protein dsbA
    Species: Escherichia coli [TaxId:562]
    Gene: dsbA; ppfA, dsf;
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991 (0-End)
      • engineered (32)
    Domains in SCOPe 2.07: d1u3ae_
  • Heterogens: PE5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u3aA (A:)
    aqyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3aA (A:)
    qyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylsek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u3aB (B:)
    aqyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3aB (B:)
    qyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylsek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u3aD (D:)
    aqyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3aD (D:)
    qyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyhv
    nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
    ydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyadt
    vkylsek
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u3aE (E:)
    aqyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u3aE (E:)
    aqyedgkqyttlekpvagapqvleffsffcphayqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek