PDB entry 1u39

View 1u39 on RCSB PDB site
Description: Auto-inhibition Mechanism of X11s/Mints Family Scaffold Proteins Revealed by the Closed Conformation of the Tandem PDZ Domains
Class: protein transport
Keywords: X11s/Mints, PDZ domain, scaffold protein, protein trafficking, PROTEIN TRANSPORT
Deposited on 2004-07-21, released 2005-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta A4 precursor protein-binding, family A, member 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u39a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u39A (A:)
    ppvttvlirrpdlryqlgfsvqngiicslmrggiaerggvrvghriieingqsvvatphe
    kivhilsnavgeihmktmpa