PDB entry 1u37

View 1u37 on RCSB PDB site
Description: Auto-inhibition Mechanism of X11s/Mints Family Scaffold Proteins Revealed by the Closed Conformation of the Tandem PDZ Domains
Class: protein transport
Keywords: X11s/Mints, PDZ domain, scaffold protein, protein trafficking
Deposited on 2004-07-21, released 2005-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-09-13, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid beta A4 precursor protein-binding, family A, member 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02410 (2-88)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1u37a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u37A (A:)
    efkdvfiekqkgeilgvvivesgwgsilptviianmmhggpaeksgklnigdqimsingt
    slvglplstcqsiikglknqsrvklnivr