PDB entry 1u36

View 1u36 on RCSB PDB site
Description: Crystal stucture of WLAC mutant of dimerisation domain of NF-kB p50 transcription factor
Class: transcription
Keywords: transcription factor; nf-kb; dimerization domain; intertwined folding
Deposited on 2004-07-21, released 2004-08-17
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.187
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear factor NF-kappa-B p105 subunit
    Species: MUS MUSCULUS
    Gene: Nfkb1, 18033
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25799 (Start-105)
      • engineered (22)
      • engineered (65)
    Domains in SCOP 1.75: d1u36a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u36A (A:)
    asnlkivrmdrtagcvtggeeiwllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
    rqfaicfktpkykdvnitkpasvfvqlrrksdletsepkpflyype
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u36A (A:)
    nlkivrmdrtagcvtggeeiwllcdkvqkddiqirfyeeevwegfgdfsptdvhrqfaic
    fktpkykdvnitkpasvfvqlrrksdletsepkpflyype