PDB entry 1u32

View 1u32 on RCSB PDB site
Description: Crystal structure of a Protein Phosphatase-1: Calcineurin Hybrid Bound to Okadaic Acid
Class: hydrolase
Keywords: hydrolase
Deposited on 2004-07-20, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.218
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine protein phosphatase pp1-gamma catalytic subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: Ppp1cc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36873 (0-292)
      • engineered (267-271)
    Domains in SCOPe 2.07: d1u32a_
  • Heterogens: MN, OKA, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u32A (A:)
    klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
    hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
    ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
    irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
    rahqvvedgyeffakrqlvtlfsapnyldvynnagammsvdetlmcsfqilkp