PDB entry 1u2z

View 1u2z on RCSB PDB site
Description: Crystal structure of histone K79 methyltransferase Dot1p from yeast
Deposited on 2004-07-20, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.213
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1u2za_
  • Chain 'B':
    Domains in SCOP 1.69: d1u2zb_
  • Chain 'C':
    Domains in SCOP 1.69: d1u2zc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2zA (A:)
    mghhhhhhkkplkkgrankkndrdspsstfvdwngpclrlqyplfdieylrsheiysgtp
    iqsislrtnspqptsltsdndtssvttaklqsilfsnymeeykvdfkrstaiynpmseig
    klieysclvflpspyaeqlketilpdlnasfdnsdtkgfvnainlynkmireiprqriid
    hletidkiprsfihdflhivytrsihpqanklkhykafsnyvygellpnflsdvyqqcql
    kkgdtfmdlgsgvgncvvqaalecgcalsfgceimddasdltilqyeelkkrcklygmrl
    nnvefslkksfvdnnrvaelipqcdvilvnnflfdedlnkkvekilqtakvgckiislks
    lrsltyqinfynvenifnrlkvqrydlkedsvswthsggeyyistvmedvdeslfspaar
    grrnrgtpvkytr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2zA (A:)
    sstfvdwngpclrlqyplfdieylrsheiysgtpiqsislrttaklqsilfsnymeeykv
    dfkrstaiynpmseigklieysclvflpspyaeqlketilpdlnasfdnsdtkgfvnain
    lynkmireiprqriidhletidkiprsfihdflhivytrsihpqanklkhykafsnyvyg
    ellpnflsdvyqqcqlkkgdtfmdlgsgvgncvvqaalecgcalsfgceimddasdltil
    qyeelkkrcklygmrlnnvefslkksfvdnnrvaelipqcdvilvnnflfdedlnkkvek
    ilqtakvgckiislkslrsltyqinfynvenifnrlkvqrydlkedsvswthsggeyyis
    tvmedvdeslfsparvkyt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2zB (B:)
    mghhhhhhkkplkkgrankkndrdspsstfvdwngpclrlqyplfdieylrsheiysgtp
    iqsislrtnspqptsltsdndtssvttaklqsilfsnymeeykvdfkrstaiynpmseig
    klieysclvflpspyaeqlketilpdlnasfdnsdtkgfvnainlynkmireiprqriid
    hletidkiprsfihdflhivytrsihpqanklkhykafsnyvygellpnflsdvyqqcql
    kkgdtfmdlgsgvgncvvqaalecgcalsfgceimddasdltilqyeelkkrcklygmrl
    nnvefslkksfvdnnrvaelipqcdvilvnnflfdedlnkkvekilqtakvgckiislks
    lrsltyqinfynvenifnrlkvqrydlkedsvswthsggeyyistvmedvdeslfspaar
    grrnrgtpvkytr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2zB (B:)
    stfvdwngpclrlqyplfdieylrsheiysgtpiqsislrtttaklqsilfsnymeeykv
    dfkrstaiynpmseigklieysclvflpspyaeqlketilpdlnasfdnsdtkgfvnain
    lynkmireiprqriidhletidkiprsfihdflhivytrsihpqanklkhykafsnyvyg
    ellpnflsdvyqqcqlkkgdtfmdlgsgvgncvvqaalecgcalsfgceimddasdltil
    qyeelkkrcklygmrlnnvefslkksfvdnnrvaelipqcdvilvnnflfdedlnkkvek
    ilqtakvgckiislkslrsltyqinfynvenifnrlkvqrydlkedsvswthsggeyyis
    tvmedvdeslfsprpvkyt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u2zC (C:)
    mghhhhhhkkplkkgrankkndrdspsstfvdwngpclrlqyplfdieylrsheiysgtp
    iqsislrtnspqptsltsdndtssvttaklqsilfsnymeeykvdfkrstaiynpmseig
    klieysclvflpspyaeqlketilpdlnasfdnsdtkgfvnainlynkmireiprqriid
    hletidkiprsfihdflhivytrsihpqanklkhykafsnyvygellpnflsdvyqqcql
    kkgdtfmdlgsgvgncvvqaalecgcalsfgceimddasdltilqyeelkkrcklygmrl
    nnvefslkksfvdnnrvaelipqcdvilvnnflfdedlnkkvekilqtakvgckiislks
    lrsltyqinfynvenifnrlkvqrydlkedsvswthsggeyyistvmedvdeslfspaar
    grrnrgtpvkytr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2zC (C:)
    sstfvdwngpclrlqyplfdieylrsheiysgtpiqsislrtttaklqsilfsnymeeyk
    vdfkrstaiynpmseigklieysclvflpspyaeqlketilpdlnasfdnsdtkgfvnai
    nlynkmireiprqriidhletidkiprsfihdflhivytrsihpqanklkhykafsnyvy
    gellpnflsdvyqqcqlkkgdtfmdlgsgvgncvvqaalecgcalsfgceimddasdlti
    lqyeelkkrcklygmrlnnvefslkksfvdnnrvaelipqcdvilvnnflfdedlnkkve
    kilqtakvgckiislkslrsltyqinfynvenifnrlkvqrydlkedsvswthsggeyyi
    stvmedvdeslfspaarrtpvkytr