PDB entry 1u2x

View 1u2x on RCSB PDB site
Description: Crystal Structure of a Hypothetical ADP-dependent Phosphofructokinase from Pyrococcus horikoshii OT3
Class: transferase
Keywords: ADP-Pfk, Pyrococcus, Midwest Center for Structural Genomics, APC5054, protein structure initiative, PSI, MCSG, TRANSFERASE
Deposited on 2004-07-20, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-10-17, with a file datestamp of 2012-10-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.177
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-specific phosphofructokinase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59355 (22-471)
      • modified residue (22)
      • modified residue (100)
      • modified residue (342)
      • modified residue (362)
      • modified residue (430)
    Domains in SCOPe 2.07: d1u2xa_
  • Chain 'B':
    Compound: ADP-specific phosphofructokinase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59355 (22-471)
      • modified residue (22)
      • modified residue (100)
      • modified residue (342)
      • modified residue (362)
      • modified residue (430)
    Domains in SCOPe 2.07: d1u2xb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2xA (A:)
    mgsshhhhhhssgrenlyfqghmipehlsiytaynanidaivklnqetiqnlinafdpde
    vkrrieeypreinepidfvarlvhtlklgkpaavplvnekmnewfdktfryeeerlggqa
    giiantlaglkirkviaytpflpkrlaelfkkgvlypvvengelqfkpiqeayregdplk
    inrifefrkglkfklgdetieipnsgrfivsarfesisrietredikpflgeigkevdga
    ifsgyqglrtkysdgkdanyylrrakediiefkekdvkihvefasvqdrklrkkiitnil
    pfvdsvgideaeiaqilsvlgyreladriftynrledsilggmiildelnfeilqvhtty
    ylmyithrdnplseeelakslefgttlaaaraslgdirgpddykvglkvpfnerseyvkl
    rfeeaksrlrmreykvvviptrlvqnpvltvglgdtisagafltyleflkrhgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2xA (A:)
    mipehlsiytaynanidaivklnqetiqnlinafdpdevkrrieeypreinepidfvarl
    vhtlklgkpaavplvnekmnewfdktfryeeerlggqagiiantlaglkirkviaytpfl
    pkrlaelfkkgvlypvvengelqfkpiqeayregdplkinrifefrkglkfklgdetiei
    pnsgrfivsarfesisrietredikpflgeigkevdgaifsgyqglrtkysdgkdanyyl
    rrakediiefkekdvkihvefasvqdrklrkkiitnilpfvdsvgideaeiaqilsvlgy
    reladriftynrledsilggmiildelnfeilqvhttyylmyithrdnplseeelaksle
    fgttlaaaraslgdirgpddykvglkvpfnerseyvklrfeeaksrlrmreykvvviptr
    lvqnpvltvglgdtisagafltyleflkrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2xB (B:)
    mgsshhhhhhssgrenlyfqghmipehlsiytaynanidaivklnqetiqnlinafdpde
    vkrrieeypreinepidfvarlvhtlklgkpaavplvnekmnewfdktfryeeerlggqa
    giiantlaglkirkviaytpflpkrlaelfkkgvlypvvengelqfkpiqeayregdplk
    inrifefrkglkfklgdetieipnsgrfivsarfesisrietredikpflgeigkevdga
    ifsgyqglrtkysdgkdanyylrrakediiefkekdvkihvefasvqdrklrkkiitnil
    pfvdsvgideaeiaqilsvlgyreladriftynrledsilggmiildelnfeilqvhtty
    ylmyithrdnplseeelakslefgttlaaaraslgdirgpddykvglkvpfnerseyvkl
    rfeeaksrlrmreykvvviptrlvqnpvltvglgdtisagafltyleflkrhgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2xB (B:)
    mipehlsiytaynanidaivklnqetiqnlinafdpdevkrrieeypreinepidfvarl
    vhtlklgkpaavplvnekmnewfdktfryeeerlggqagiiantlaglkirkviaytpfl
    pkrlaelfkkgvlypvvengelqfkpiqeayregdplkinrifefrkglkfklgdetiei
    pnsgrfivsarfesisrietredikpflgeigkevdgaifsgyqglrtkysdgkdanyyl
    rrakediiefkekdvkihvefasvqdrklrkkiitnilpfvdsvgideaeiaqilsvlgy
    reladriftynrledsilggmiildelnfeilqvhttyylmyithrdnplseeelaksle
    fgttlaaaraslgdirgpddykvglkvpfnerseyvklrfeeaksrlrmreykvvviptr
    lvqnpvltvglgdtisagafltyleflkrh