PDB entry 1u2t

View 1u2t on RCSB PDB site
Description: X-Ray structure of the sucrose-phosphatase (SPP) from Synechocystis sp. PCC6803 in complex with sucrose6P
Class: hydrolase
Keywords: phosphohydrolase; HAD superfamily; sucrose; sucrose6P; cyanobacteria, HYDROLASE
Deposited on 2004-07-20, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sucrose-phosphatase (SPP)
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: spp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u2ta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1u2tA (A:)
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls