PDB entry 1u2s

View 1u2s on RCSB PDB site
Description: X-Ray structure of the sucrose-phosphatase (SPP) from Synechocystis sp. PCC6803 in complex with glucose
Class: hydrolase
Keywords: phosphohydrolase, HAD superfamily, sucrose, glucose, cyanobacteria
Deposited on 2004-07-20, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose-Phosphatase
    Species: Synechocystis sp. PCC 6803 [TaxId:1148]
    Gene: spp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2sa_
  • Heterogens: GLC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u2sA (A:)
    mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
    dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
    ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
    tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
    dfls