PDB entry 1u2q

View 1u2q on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis Low Molecular Weight Protein Tyrosine Phosphatase (MPtpA) at 2.5A resolution with glycerol in the active site
Class: hydrolase
Keywords: Hydrolase, tyrosine phosphatase, mycobacterium tuberculosis
Deposited on 2004-07-20, released 2005-03-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low molecular weight protein-tyrosine-phosphatase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MPTPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u2qa_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2qA (A:)
    msdplhvtfvctgnicrspmaekmfaqqlrhrglgdavrvtsagtgnwhvgscaderaag
    vlrahgyptdhraaqvgtehlaadllvaldrnharllrqlgveaarvrmlrsfdprsgth
    aldvedpyygdhsdfeevfaviesalpglhdwvderlarngps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2qA (A:)
    plhvtfvctgnicrspmaekmfaqqlrhrglgdavrvtsagtgnwhvgscaderaagvlr
    ahgyptdhraaqvgtehlaadllvaldrnharllrqlgveaarvrmlrsfdprsgthald
    vedpyygdhsdfeevfaviesalpglhdwvderla