PDB entry 1u2p

View 1u2p on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis Low Molecular Protein Tyrosine Phosphatase (MPtpA) at 1.9A resolution
Class: hydrolase
Keywords: Hydrolase, tyrosine phosphatase, mycobacterium
Deposited on 2004-07-20, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low molecular weight protein-tyrosine-phosphatase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MPTPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2pa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2pA (A:)
    msdplhvtfvctgnicrspmaekmfaqqlrhrglgdavrvtsagtgnwhvgscaderaag
    vlrahgyptdhraaqvgtehlaadllvaldrnharllrqlgveaarvrmlrsfdprsgth
    aldvedpyygdhsdfeevfaviesalpglhdwvderlarngps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2pA (A:)
    plhvtfvctgnicrspmaekmfaqqlrhrglgdavrvtsagtgnwhvgscaderaagvlr
    ahgyptdhraaqvgtehlaadllvaldrnharllrqlgveaarvrmlrsfdprsgthald
    vedpyygdhsdfeevfaviesalpglhdwvderlar