PDB entry 1u2o

View 1u2o on RCSB PDB site
Description: Crystal Structure Of The N-Domain Of Grp94 Lacking The Charged Domain In Complex With Neca
Class: chaperone
Keywords: GRP94, Hsp90, Bergerat, Chaperone, Endoplasmic reticulum, NECA
Deposited on 2004-07-19, released 2004-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (226-235)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d1u2oa1, d1u2oa2
  • Chain 'B':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (226-235)
      • cloning artifact (0-3)
    Domains in SCOPe 2.06: d1u2ob1, d1u2ob2
  • Heterogens: NEC, PG4, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2oA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2oA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkmteaqestse
    ligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlv
    lkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2oB (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2oB (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtigtseflnkmteaqestse
    ligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlv
    lkeeasdyleldtiknlvkkysqfinfpiyvwssktktvwdwelmn