PDB entry 1u2n

View 1u2n on RCSB PDB site
Description: Structure CBP TAZ1 Domain
Class: Transferase
Keywords: TAZ1, CBP, TAZ2, p300, CH1, CH3, Transferase
Deposited on 2004-07-19, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CREB Binding Protein
    Species: Mus musculus [TaxId:10090]
    Gene: CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2na_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1u2nA (A:)
atgptadpekrkliqqqlvlllhahkcqrreqangevracslphcrtmknvlnhmthcqa
pkacqvahcassrqiishwknctrhdcpvclplknasdkr