PDB entry 1u2m

View 1u2m on RCSB PDB site
Description: Crystal Structure of Skp
Class: chaperone
Keywords: coiled coil, chaperone
Deposited on 2004-07-19, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-like protein HLP-1
    Species: Escherichia coli [TaxId:562]
    Gene: HLPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEU7 (2-142)
      • cloning artifact (0-1)
      • modified residue (10)
    Domains in SCOPe 2.07: d1u2ma1, d1u2ma2
  • Chain 'B':
    Compound: Histone-like protein HLP-1
    Species: Escherichia coli [TaxId:562]
    Gene: HLPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEU7 (Start-142)
      • modified residue (10)
      • modified residue (41)
    Domains in SCOPe 2.07: d1u2mb_
  • Chain 'C':
    Compound: Histone-like protein HLP-1
    Species: Escherichia coli [TaxId:562]
    Gene: HLPA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AEU7 (2-142)
      • cloning artifact (0-1)
      • modified residue (10)
      • modified residue (41)
      • modified residue (49)
      • modified residue (55)
      • modified residue (69)
    Domains in SCOPe 2.07: d1u2mc1, d1u2mc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2mA (A:)
    gmadkiaivnmgslfqqvaqktgvsntlenefkgraselqrmetdlqakmkklqsmkags
    drtklekdvmaqrqtfaqkaqafeqdrarrsneergklvtriqtavksvansqdidlvvd
    anavaynssdvkditadvlkqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2mA (A:)
    gmadkiaivnmgslfqqvaqktgvsntlerarrsneergklvtriqtavksvansqdidl
    vvdanavaynssdvkditadvlkqvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2mB (B:)
    gmadkiaivnmgslfqqvaqktgvsntlenefkgraselqrmetdlqakmkklqsmkags
    drtklekdvmaqrqtfaqkaqafeqdrarrsneergklvtriqtavksvansqdidlvvd
    anavaynssdvkditadvlkqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2mB (B:)
    kiaivnmgslfqqvaqktgvsntlenefkgraselqrmetdlqakrqtfaqkaqafeqdr
    arrsneergklvtriqtavksvansqdidlvvdanavaynssdvkditadvlkqvk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u2mC (C:)
    gmadkiaivnmgslfqqvaqktgvsntlenefkgraselqrmetdlqakmkklqsmkags
    drtklekdvmaqrqtfaqkaqafeqdrarrsneergklvtriqtavksvansqdidlvvd
    anavaynssdvkditadvlkqvk