PDB entry 1u2l

View 1u2l on RCSB PDB site
Description: Crystal structure of the C-terminal domain from the catalase-peroxidase KatG of Escherichia coli (P1)
Class: oxidoreductase
Keywords: KatG, catalase-peroxidase, C-terminal domain
Deposited on 2004-07-19, released 2004-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2004-10-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13029 (4-308)
      • cloning artifact (2-3)
    Domains in SCOP 1.75: d1u2la_
  • Chain 'B':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli
    Gene: katG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13029 (4-308)
      • cloning artifact (2-3)
    Domains in SCOP 1.75: d1u2lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2lA (A:)
    gshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasast
    frggdkrggangarlalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgv
    ekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllid
    kaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatd
    eskelfegrdretgevkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkv
    mnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2lA (A:)
    hmyigpevpkedliwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfr
    ggdkrggangarlalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvek
    aasaaglsihvpfapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidka
    qqltltapemtalvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdes
    kelfegrdretgevkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmn
    ldrfdll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2lB (B:)
    gshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasast
    frggdkrggangarlalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgv
    ekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllid
    kaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatd
    eskelfegrdretgevkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkv
    mnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2lB (B:)
    hmyigpevpkedliwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfr
    ggdkrggangarlalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvek
    aasaaglsihvpfapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidka
    qqltltapemtalvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdes
    kelfegrdretgevkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmn
    ldrfdll