PDB entry 1u2k

View 1u2k on RCSB PDB site
Description: Crystal structure of the C-terminal domain from the catalase-peroxidase KatG of Escherichia coli (I41)
Class: oxidoreductase
Keywords: KatG, catalase-peroxidase, C-terminal domain, oxidoreductase
Deposited on 2004-07-19, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli [TaxId:562]
    Gene: katG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2ka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2kA (A:)
    gshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasast
    frggdkrggangarlalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgv
    ekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllid
    kaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatd
    eskelfegrdretgevkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkv
    mnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2kA (A:)
    qdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangarlal
    mpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvpfap
    grvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemtalvg
    gmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretgevk
    ftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll