PDB entry 1u2j

View 1u2j on RCSB PDB site
Description: Crystal structure of the C-terminal domain from the catalase-peroxidase KatG of Escherichia coli (P21 21 21)
Class: oxidoreductase
Keywords: KatG, catalase-peroxidase, C-terminal domain, OXIDOREDUCTASE
Deposited on 2004-07-19, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.243
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli [TaxId:562]
    Gene: katG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2ja_
  • Chain 'B':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli [TaxId:562]
    Gene: katG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2jb_
  • Chain 'C':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli [TaxId:562]
    Gene: katG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2jc_
  • Chain 'D':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli [TaxId:562]
    Gene: katG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2jd_
  • Chain 'E':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli [TaxId:562]
    Gene: katG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2je_
  • Chain 'F':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli [TaxId:562]
    Gene: katG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2jf_
  • Chain 'G':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli [TaxId:562]
    Gene: katG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2jg_
  • Chain 'H':
    Compound: Peroxidase/catalase HPI
    Species: Escherichia coli [TaxId:562]
    Gene: katG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u2jh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2jA (A:)
    mgsshhhhhhssglvprgshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiads
    glsvselvsvawasastfrggdkrggangarlalmpqrdwdvnaaavralpvlekiqkes
    gkasladiivlagvvgvekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfr
    nyrarldvsttesllidkaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsn
    dffvnlldmryewkatdeskelfegrdretgevkftasradlvfgsnsvlravaevyass
    dahekfvkdfvaawvkvmnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2jA (A:)
    liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
    lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
    fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
    lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
    evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2jB (B:)
    mgsshhhhhhssglvprgshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiads
    glsvselvsvawasastfrggdkrggangarlalmpqrdwdvnaaavralpvlekiqkes
    gkasladiivlagvvgvekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfr
    nyrarldvsttesllidkaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsn
    dffvnlldmryewkatdeskelfegrdretgevkftasradlvfgsnsvlravaevyass
    dahekfvkdfvaawvkvmnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2jB (B:)
    liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
    lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
    fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
    lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
    evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u2jC (C:)
    mgsshhhhhhssglvprgshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiads
    glsvselvsvawasastfrggdkrggangarlalmpqrdwdvnaaavralpvlekiqkes
    gkasladiivlagvvgvekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfr
    nyrarldvsttesllidkaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsn
    dffvnlldmryewkatdeskelfegrdretgevkftasradlvfgsnsvlravaevyass
    dahekfvkdfvaawvkvmnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2jC (C:)
    liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
    lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
    fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
    lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
    evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u2jD (D:)
    mgsshhhhhhssglvprgshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiads
    glsvselvsvawasastfrggdkrggangarlalmpqrdwdvnaaavralpvlekiqkes
    gkasladiivlagvvgvekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfr
    nyrarldvsttesllidkaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsn
    dffvnlldmryewkatdeskelfegrdretgevkftasradlvfgsnsvlravaevyass
    dahekfvkdfvaawvkvmnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2jD (D:)
    liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
    lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
    fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
    lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
    evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u2jE (E:)
    mgsshhhhhhssglvprgshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiads
    glsvselvsvawasastfrggdkrggangarlalmpqrdwdvnaaavralpvlekiqkes
    gkasladiivlagvvgvekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfr
    nyrarldvsttesllidkaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsn
    dffvnlldmryewkatdeskelfegrdretgevkftasradlvfgsnsvlravaevyass
    dahekfvkdfvaawvkvmnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2jE (E:)
    liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
    lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
    fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
    lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
    evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u2jF (F:)
    mgsshhhhhhssglvprgshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiads
    glsvselvsvawasastfrggdkrggangarlalmpqrdwdvnaaavralpvlekiqkes
    gkasladiivlagvvgvekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfr
    nyrarldvsttesllidkaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsn
    dffvnlldmryewkatdeskelfegrdretgevkftasradlvfgsnsvlravaevyass
    dahekfvkdfvaawvkvmnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2jF (F:)
    liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
    lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
    fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
    lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
    evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1u2jG (G:)
    mgsshhhhhhssglvprgshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiads
    glsvselvsvawasastfrggdkrggangarlalmpqrdwdvnaaavralpvlekiqkes
    gkasladiivlagvvgvekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfr
    nyrarldvsttesllidkaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsn
    dffvnlldmryewkatdeskelfegrdretgevkftasradlvfgsnsvlravaevyass
    dahekfvkdfvaawvkvmnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2jG (G:)
    liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
    lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
    fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
    lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
    evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1u2jH (H:)
    mgsshhhhhhssglvprgshmyigpevpkedliwqdplpqpiynpteqdiidlkfaiads
    glsvselvsvawasastfrggdkrggangarlalmpqrdwdvnaaavralpvlekiqkes
    gkasladiivlagvvgvekaasaaglsihvpfapgrvdarqdqtdiemfellepiadgfr
    nyrarldvsttesllidkaqqltltapemtalvggmrvlganfdgskngvftdrvgvlsn
    dffvnlldmryewkatdeskelfegrdretgevkftasradlvfgsnsvlravaevyass
    dahekfvkdfvaawvkvmnldrfdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2jH (H:)
    liwqdplpqpiynpteqdiidlkfaiadsglsvselvsvawasastfrggdkrggangar
    lalmpqrdwdvnaaavralpvlekiqkesgkasladiivlagvvgvekaasaaglsihvp
    fapgrvdarqdqtdiemfellepiadgfrnyrarldvsttesllidkaqqltltapemta
    lvggmrvlganfdgskngvftdrvgvlsndffvnlldmryewkatdeskelfegrdretg
    evkftasradlvfgsnsvlravaevyassdahekfvkdfvaawvkvmnldrfdll