PDB entry 1u2h
View 1u2h on RCSB PDB site
Description: X-ray Structure of the N-terminally truncated human APEP-1
Class: contractile protein
Keywords: Structural Genomics, Ig-fold I-set, RGD motif, Homophilic Adhesion, Arterial Smooth Muscle Cells, Atherosclerosis, CONTRACTILE PROTEIN
Deposited on
2004-07-19, released
2005-07-05
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 0.96 Å
R-factor: 0.161
AEROSPACI score: 1.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Aortic preferentially expressed protein 1
Species: Homo sapiens [TaxId:9606]
Gene: Arotic Preferentially Expressed Gene 1
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1u2ha_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1u2hA (A:)
gskapptfkvslmdqsvregqdvimsirvqgepkpvvswlrnrqpvrpdqrrfaeeaegg
lcrlrilaaergdagfytckavneygarqcearlevrge
Sequence, based on observed residues (ATOM records): (download)
>1u2hA (A:)
kapptfkvslmdqsvregqdvimsirvqgepkpvvswlrnrqpvrpdqrrfaeeaegglc
rlrilaaergdagfytckavneygarqcearlevrg