PDB entry 1u2g

View 1u2g on RCSB PDB site
Description: transhydrogenase (dI.ADPr)2(dIII.NADPH)1 asymmetric complex
Class: oxidoreductase
Keywords: NAD(P) transhydrogenase subunits, NAD+, NADP+, OXIDOREDUCTASE
Deposited on 2004-07-19, released 2005-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.222
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2ga1, d1u2ga2
  • Chain 'B':
    Compound: NAD(P) transhydrogenase subunit alpha part 1
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntAA, nntA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2gb1, d1u2gb2
  • Chain 'C':
    Compound: NAD(P) transhydrogenase subunit beta
    Species: Rhodospirillum rubrum [TaxId:1085]
    Gene: pntB, nntB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u2gc_
  • Heterogens: APR, NDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2gA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2gA (A:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u2gB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvddeamktaetaggyakemg
    eefrkkqaeavlkelvktdiaittalipgkpapvliteemvtkmkpgsviidlaveaggn
    cplsepgkivvkhgvkivghtnvpsrvaadasplfaknllnfltphvdkdtktlvmkled
    etvsgtcvtrdgaivhpaltgqga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2gB (B:)
    mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
    aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
    amelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagtvpparvlvfgv
    gvaglqaiatakrlgavvmatdvraatkeqveslggkfitvrkkqaeavlkelvktdiai
    ttalipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtn
    vpsrvaadasplfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpaltg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u2gC (C:)
    mnrsifnvilggfgseggvaaaggaagdrsvkagsaedaafimknaskviivpgygmava
    qaqhalremadvlkkegvevsyaihpvagrmpghmnvllaeanvpydevfeleeinssfq
    tadvafvigandvtnpaaktdpsspiygmpildvekagtvlfikrsmasgyagvenelff
    rnntmmlfgdakkmteqivqamn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2gC (C:)
    svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
    rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
    pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn