PDB entry 1u2c

View 1u2c on RCSB PDB site
Description: Crystal Structure of a-dystroglycan
Deposited on 2004-07-18, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u2cA (A:)
    avptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwdphshileg
    lpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnepqsvraassdpgevvp
    sacaadepvtvltvildadltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdms
    afmagpgnakkvvengallswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhi
    ankkpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u2cA (A:)
    avptvvgipdgtavvgrsfrvsiptdliassgeiikvsaagkealpswlhwdphshileg
    lpldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnacaadepvtvltvilda
    dltkmtpkqridllnrmqsfsevelhnmklvpvvnnrlfdmsafmagpgnakkvvengal
    lswklgcslnqnsvpdirgvetparegamsaqlgypvvgwhiankkpt