PDB entry 1u29

View 1u29 on RCSB PDB site
Description: Triglycine variant of the ARNO Pleckstrin Homology Domain in complex with Ins(1,4,5)P3
Class: lipid binding protein
Keywords: PH domain, lipid binding, phosphoinositide, LIPID BINDING PROTEIN
Deposited on 2004-07-16, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.23
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytohesin 2
    Species: Mus musculus [TaxId:10090]
    Gene: Pscd2, Sec7b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u29a_
  • Heterogens: I3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1u29A (A:)
mghhhhhhgspdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenl
sirevddprkpncfelyipnnkgqlikackteadgrvvegnhmvyrisaptqeekdewik
siqaavsvd

    Sequence, based on observed residues (ATOM records): (download) 
    >1u29A (A:)
pdregwllklgggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevddprk
pncfelyipnnkgqlikackteadgrvvegnhmvyrisaptqeekdewiksiqaavsvd