PDB entry 1u24

View 1u24 on RCSB PDB site
Description: Crystal structure of Selenomonas ruminantium phytase
Class: hydrolase
Keywords: PTP, P-loop, phytase, hydrolase
Deposited on 2004-07-16, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myo-inositol hexaphosphate phosphohydrolase
    Species: Selenomonas ruminantium [TaxId:971]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WUJ1 (Start-334)
      • modified residue (85)
      • modified residue (202)
      • modified residue (251)
      • modified residue (253)
      • modified residue (256)
      • modified residue (303)
      • cloning artifact (335)
    Domains in SCOPe 2.07: d1u24a1, d1u24a2
  • Chain 'B':
    Compound: myo-inositol hexaphosphate phosphohydrolase
    Species: Selenomonas ruminantium [TaxId:971]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WUJ1 (Start-334)
      • modified residue (85)
      • modified residue (202)
      • modified residue (251)
      • modified residue (253)
      • modified residue (256)
      • modified residue (303)
      • cloning artifact (335)
    Domains in SCOPe 2.07: d1u24b1, d1u24b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u24A (A:)
    masmtggqqmgrgsefakapeqtvtepvgsyaraerpqdfegfvwrldndgkealprnfr
    tsadalrapekkfhldaayvpsregmdalhisgssaftpaqlknvaaklrektagpiydv
    dlrqeshgyldgipvswygerdwanlgksqhealaderhrlhaalhktvyiaplgkhklp
    eggevrrvqkvqteqevaeaagmryfriaatdhvwptpenidrflafyrtlpqdawlhfh
    ceagvgrttafmvmtdmlknpsvslkdilyrqheiggfyygefpiktkdkdswktkyyre
    kivmieqfyryvqenradgyqtpwsvwlkshpakale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u24A (A:)
    tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
    regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
    wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
    mryfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknps
    vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
    pwsvwlkshpakal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u24B (B:)
    masmtggqqmgrgsefakapeqtvtepvgsyaraerpqdfegfvwrldndgkealprnfr
    tsadalrapekkfhldaayvpsregmdalhisgssaftpaqlknvaaklrektagpiydv
    dlrqeshgyldgipvswygerdwanlgksqhealaderhrlhaalhktvyiaplgkhklp
    eggevrrvqkvqteqevaeaagmryfriaatdhvwptpenidrflafyrtlpqdawlhfh
    ceagvgrttafmvmtdmlknpsvslkdilyrqheiggfyygefpiktkdkdswktkyyre
    kivmieqfyryvqenradgyqtpwsvwlkshpakale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u24B (B:)
    tvtepvgsyaraerpqdfegfvwrldndgkealprnfrtsadalrapekkfhldaayvps
    regmdalhisgssaftpaqlknvaaklrektagpiydvdlrqeshgyldgipvswygerd
    wanlgksqhealaderhrlhaalhktvyiaplgkhklpeggevrrvqkvqteqevaeaag
    mryfriaatdhvwptpenidrflafyrtlpqdawlhfhceagvgrttafmvmtdmlknps
    vslkdilyrqheiggfyygefpiktkdkdswktkyyrekivmieqfyryvqenradgyqt
    pwsvwlkshpakal