PDB entry 1u22

View 1u22 on RCSB PDB site
Description: A. thaliana cobalamine independent methionine synthase
Class: transferase
Keywords: methionine,synthase,homocysteine,methyltetrahydrofolate, transferase
Deposited on 2004-07-16, released 2004-09-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.2
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: CIMS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O50008
      • modified residue (10)
      • modified residue (48)
      • modified residue (73)
      • modified residue (96)
      • modified residue (106)
      • modified residue (108)
      • modified residue (211)
      • modified residue (350)
      • modified residue (495)
      • modified residue (537)
      • modified residue (544)
      • modified residue (548)
      • modified residue (553)
      • modified residue (556)
      • modified residue (647)
      • modified residue (662)
      • modified residue (717)
      • modified residue (749)
    Domains in SCOPe 2.08: d1u22a1, d1u22a2
  • Heterogens: ZN, SO4, HCS, THG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u22A (A:)
    mashivgyprmgpkrelkfalesfwdgkstaedlqkvsadlrssiwkqmsaagtkfipsn
    tfahydqvldttamlgavpprygytggeigldvyfsmargnasvpamemtkwfdtnyhyi
    vpelgpevnfsyashkavneykeakalgvdtvpvlvgpvsylllskaakgvdksfellsl
    lpkilpiykevitelkaagatwiqldepvlvmdlegqklqaftgayaelestlsglnvlv
    etyfadipaeayktltslkgvtafgfdlvrgtktldlvkagfpegkylfagvvdgrniwa
    ndfaaslstlqalegivgkdklvvstscsllhtavdlinetklddeikswmafaaqkvve
    vnalakalagqkdealfsanaaalasrrssprvtnegvqkaaaalkgsdhrratnvsarl
    daqqkklnlpilptttigsfpqtvelrrvrreykakkvseedyvkaikeeikkvvdlqee
    ldidvlvhgeperndmveyfgeqlsgfaftangwvqsygsrcvkppviygdvsrpkamtv
    fwsamaqsmtsrpmkgmltgpvtilnwsfvrndqprhetcyqialaikdevedlekggig
    viqideaalreglplrksehafyldwavhsfritncgvqdstqihthmcyshfndiihsi
    idmdadvitiensrsdekllsvfregvkygagigpgvydihspripsseeiadrvnkmla
    vleqnilwvnpdcglktrkytevkpalknmvdaaklirsqlasak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u22A (A:)
    ashivgyprmgpkrelkfalesfwdgkstaedlqkvsadlrssiwkqmsaagtkfipsnt
    fahydqvldttamlgavpprygytggeigldvyfsmargnasvpamemtkwfdtnyhyiv
    pelgpevnfsyashkavneykeakalgvdtvpvlvgpvsylllskaakgvdksfellsll
    pkilpiykevitelkaagatwiqldepvlvmdlegqklqaftgayaelestlsglnvlve
    tyfadipaeayktltslkgvtafgfdlvrgtktldlvkagfpegkylfagvvdgrniwan
    dfaaslstlqalegivgkdklvvstscsllhtavdlinetklddeikswmafaaqkvvev
    nalakalagqkdealfsanaaalasrrssprvtnegvqkaaaalkgsdhrratnvsarld
    aqqkklnlpilptttigsfpqtvelredyvkaikeeikkvvdlqeeldidvlvhgepern
    dmveyfgeqlsgfaftangwvqsygsrcvkppviygdvsrpkamtvfwsamaqsmtsrpm
    kgmltgpvtilnwsfvrndqprhetcyqialaikdevedlekggigviqideaalreglp
    lrksehafyldwavhsfritncgvqdstqihthmcyshfndiihsiidmdadvitiensr
    sdekllsvfregvkygagigpgvydihspripsseeiadrvnkmlavleqnilwvnpdcg
    lktrkytevkpalknmvdaaklirsq