PDB entry 1u1z

View 1u1z on RCSB PDB site
Description: The Structure of (3R)-hydroxyacyl-ACP dehydratase (FabZ)
Class: lyase
Keywords: dehydratase; fatty acid biosynthesis; hot dog fold, LYASE
Deposited on 2004-07-16, released 2004-09-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.234
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXY7 (20-End)
      • modified residue (20-21)
      • modified residue (75)
      • modified residue (84)
      • modified residue (95)
    Domains in SCOPe 2.03: d1u1za_
  • Chain 'B':
    Compound: (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXY7 (20-165)
      • modified residue (20-21)
      • modified residue (75)
      • modified residue (84)
      • modified residue (95)
    Domains in SCOPe 2.03: d1u1zb_
  • Chain 'C':
    Compound: (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXY7 (20-165)
      • modified residue (20-21)
      • modified residue (75)
      • modified residue (84)
      • modified residue (95)
      • cloning artifact (166-167)
    Domains in SCOPe 2.03: d1u1zc_
  • Chain 'D':
    Compound: (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXY7 (20-165)
      • modified residue (20-21)
      • modified residue (75)
      • modified residue (84)
      • modified residue (95)
    Domains in SCOPe 2.03: d1u1zd_
  • Chain 'E':
    Compound: (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXY7 (20-165)
      • modified residue (20-21)
      • modified residue (75)
      • modified residue (84)
      • modified residue (95)
    Domains in SCOPe 2.03: d1u1ze_
  • Chain 'F':
    Compound: (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXY7 (20-165)
      • modified residue (20-21)
      • modified residue (75)
      • modified residue (84)
      • modified residue (95)
    Domains in SCOPe 2.03: d1u1zf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1zA (A:)
    mgsshhhhhhssglvprgshmmdineireylphrypfllvdrvveldiegkrirayknvs
    inepffnghfpehpimpgvliieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqp
    vlpgdqlqlhakfisvkrsiwkfdchatvddkpvcsaeiicaerklgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1zA (A:)
    mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
    iieamaqaagilgfkmldvkptlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsiwkf
    dchatvddkpvcsaeiicaerk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u1zB (B:)
    mgsshhhhhhssglvprgshmmdineireylphrypfllvdrvveldiegkrirayknvs
    inepffnghfpehpimpgvliieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqp
    vlpgdqlqlhakfisvkrsiwkfdchatvddkpvcsaeiicaerklgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1zB (B:)
    mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
    iieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsi
    wkfdchatvddkpvcsaeiicaerkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u1zC (C:)
    mgsshhhhhhssglvprgshmmdineireylphrypfllvdrvveldiegkrirayknvs
    inepffnghfpehpimpgvliieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqp
    vlpgdqlqlhakfisvkrsiwkfdchatvddkpvcsaeiicaerklgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1zC (C:)
    mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
    iieamaqaagilgfkmldvkdgtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsiwk
    fdchatvddkpvcsaeiicaerklgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u1zD (D:)
    mgsshhhhhhssglvprgshmmdineireylphrypfllvdrvveldiegkrirayknvs
    inepffnghfpehpimpgvliieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqp
    vlpgdqlqlhakfisvkrsiwkfdchatvddkpvcsaeiicaerklgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1zD (D:)
    mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
    iieamaqaagilgfkmldvkpgtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsiwk
    fdchatvddkpvcsaeiicaerkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u1zE (E:)
    mgsshhhhhhssglvprgshmmdineireylphrypfllvdrvveldiegkrirayknvs
    inepffnghfpehpimpgvliieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqp
    vlpgdqlqlhakfisvkrsiwkfdchatvddkpvcsaeiicaerklgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1zE (E:)
    mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
    iieamaqaagilgfkmldvkpagtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsiw
    kfdchatvddkpvcsaeiicaerkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u1zF (F:)
    mgsshhhhhhssglvprgshmmdineireylphrypfllvdrvveldiegkrirayknvs
    inepffnghfpehpimpgvliieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqp
    vlpgdqlqlhakfisvkrsiwkfdchatvddkpvcsaeiicaerklgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1zF (F:)
    mmdineireylphrypfllvdrvveldiegkrirayknvsinepffnghfpehpimpgvl
    iieamaqaagilgfkmldvkpadgtlyyfvgsdklrfrqpvlpgdqlqlhakfisvkrsi
    wkfdchatvddkpvcsaeiicaerkl