PDB entry 1u1y

View 1u1y on RCSB PDB site
Description: Crystal structure of a complex between WT bacteriophage MS2 coat protein and an F5 aptamer RNA stemloop with 2aminopurine substituted at the-10 position
Class: Virus/RNA
Keywords: Complex (Capsid protein-RNA hairpin), Hairpin, Capsid, Levivirus, Icosahedral virus, Virus/RNA COMPLEX
Deposited on 2004-07-16, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.188
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: coat protein
  Species: Enterobacteria phage MS2 [TaxId:12022]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03612 (0-128)
  Domains in SCOPe 2.08: d1u1ya_
• Chain 'B':
  Compound: coat protein
  Species: Enterobacteria phage MS2 [TaxId:12022]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03612 (0-128)
  Domains in SCOPe 2.08: d1u1yb_
• Chain 'C':
  Compound: coat protein
  Species: Enterobacteria phage MS2 [TaxId:12022]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03612 (0-128)
  Domains in SCOPe 2.08: d1u1yc_
• Chain 'R':
  Compound: 5'-r(*cp*cp*gp*gp*(2pr)p*gp*gp*ap*up*cp*ap*cp*cp*ap*cp*gp*g)-3'
  
• Chain 'S':
  Compound: 5'-r(*cp*cp*gp*gp*(2pr)p*gp*gp*ap*up*cp*ap*cp*cp*ap*cp*gp*g)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u1yA (A:)
  asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
  kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
  aiaansgiy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u1yB (B:)
  asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
  kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
  aiaansgiy
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1u1yC (C:)
  asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
  kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
  aiaansgiy
  

  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.