PDB entry 1u1x

View 1u1x on RCSB PDB site
Description: Structure and function of phenazine-biosynthesis protein PhzF from Pseudomonas fluorescens 2-79
Deposited on 2004-07-16, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.152
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1xA (A:)
    mgsshhhhhhssglvprgshmhnyviidafasvplegnpvavffdaddlppaqmqriare
    mnlsestfvlkprnggdaliriftpvnelpfaghpllgtaialgahtdnhrlyletqmgt
    iafelerqngsviaasmdqpiptwtalgrdaellkalgisdstfpieiyhngprhvfvgl
    psidalsalhpdhralsnfhdmaincfagagrrwrsrmfspaygvvedaatgsaagplai
    hlarhgqiefgqpveilqgveigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1xA (A:)
    mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
    riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
    iptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfh
    dmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgv
    eigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u1xB (B:)
    mgsshhhhhhssglvprgshmhnyviidafasvplegnpvavffdaddlppaqmqriare
    mnlsestfvlkprnggdaliriftpvnelpfaghpllgtaialgahtdnhrlyletqmgt
    iafelerqngsviaasmdqpiptwtalgrdaellkalgisdstfpieiyhngprhvfvgl
    psidalsalhpdhralsnfhdmaincfagagrrwrsrmfspaygvvedaatgsaagplai
    hlarhgqiefgqpveilqgveigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1xB (B:)
    hmhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdal
    iriftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdq
    piptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnf
    hdmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqg
    veigrpslmfakaegraeqltrvevsgngvtfgrgtivl