PDB entry 1u1x

View 1u1x on RCSB PDB site
Description: Structure and function of phenazine-biosynthesis protein PhzF from Pseudomonas fluorescens 2-79
Class: isomerase, lyase
Keywords: phenazine biosynthesis, acid/base catalysis, closed form, substrate complex, isomerase, LYASE
Deposited on 2004-07-16, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.152
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenazine biosynthesis protein phzF
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PHZF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1xa1, d1u1xa2
  • Chain 'B':
    Compound: Phenazine biosynthesis protein phzF
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PHZF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51792 (20-297)
      • cloning artifact (19)
    Domains in SCOPe 2.07: d1u1xb1, d1u1xb2, d1u1xb3
  • Heterogens: HHA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1xA (A:)
    mgsshhhhhhssglvprgshmhnyviidafasvplegnpvavffdaddlppaqmqriare
    mnlsestfvlkprnggdaliriftpvnelpfaghpllgtaialgahtdnhrlyletqmgt
    iafelerqngsviaasmdqpiptwtalgrdaellkalgisdstfpieiyhngprhvfvgl
    psidalsalhpdhralsnfhdmaincfagagrrwrsrmfspaygvvedaatgsaagplai
    hlarhgqiefgqpveilqgveigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1xA (A:)
    mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
    riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
    iptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfh
    dmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgv
    eigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u1xB (B:)
    mgsshhhhhhssglvprgshmhnyviidafasvplegnpvavffdaddlppaqmqriare
    mnlsestfvlkprnggdaliriftpvnelpfaghpllgtaialgahtdnhrlyletqmgt
    iafelerqngsviaasmdqpiptwtalgrdaellkalgisdstfpieiyhngprhvfvgl
    psidalsalhpdhralsnfhdmaincfagagrrwrsrmfspaygvvedaatgsaagplai
    hlarhgqiefgqpveilqgveigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1xB (B:)
    hmhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdal
    iriftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdq
    piptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnf
    hdmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqg
    veigrpslmfakaegraeqltrvevsgngvtfgrgtivl