PDB entry 1u1v

View 1u1v on RCSB PDB site
Description: Structure and function of phenazine-biosynthesis protein PhzF from Pseudomonas fluorescens 2-79
Class: isomerase, lyase
Keywords: phenazine biosynthesis, isomerase, open form, acid/base catalysis, LYASE
Deposited on 2004-07-16, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.131
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenazine biosynthesis protein phzF
    Species: Pseudomonas fluorescens [TaxId:294]
    Gene: PHZF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51792 (20-297)
      • modified residue (20)
      • modified residue (53)
      • modified residue (60)
      • modified residue (117)
      • modified residue (136)
      • modified residue (201)
      • modified residue (217)
      • modified residue (267)
    Domains in SCOPe 2.07: d1u1va1, d1u1va2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1vA (A:)
    mgsshhhhhhssglvprgshmhnyviidafasvplegnpvavffdaddlppaqmqriare
    mnlsestfvlkprnggdaliriftpvnelpfaghpllgtaialgahtdnhrlyletqmgt
    iafelerqngsviaasmdqpiptwtalgrdaellkalgisdstfpieiyhngprhvfvgl
    psidalsalhpdhralsnfhdmaincfagagrrwrsrmfspaygvvedaatgsaagplai
    hlarhgqiefgqpveilqgveigrpslmfakaegraeqltrvevsgngvtfgrgtivl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1vA (A:)
    mhnyviidafasvplegnpvavffdaddlppaqmqriaremnlsestfvlkprnggdali
    riftpvnelpfaghpllgtaialgahtdnhrlyletqmgtiafelerqngsviaasmdqp
    iptwtalgrdaellkalgisdstfpieiyhngprhvfvglpsidalsalhpdhralsnfh
    dmaincfagagrrwrsrmfspaygvvedaatgsaagplaihlarhgqiefgqpveilqgv
    eigrpslmfakaegraeqltrvevsgngvtfgrgtivl