PDB entry 1u1s

View 1u1s on RCSB PDB site
Description: Hfq protein from Pseudomonas aeruginosa. Low-salt crystals
Class: RNA binding protein
Keywords: Hfq, HF1, Sm-like bacterial protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-07-16, released 2005-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.223
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u1sa1
  • Chain 'B':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u1sb1
  • Chain 'C':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u1sc1
  • Chain 'D':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u1sd1
  • Chain 'E':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u1se1
  • Chain 'F':
    Compound: Hfq protein
    Species: Pseudomonas aeruginosa
    Gene: hfq
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1u1sf1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1sA (A:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1sA (A:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvrlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u1sB (B:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1sB (B:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u1sC (C:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1sC (C:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u1sD (D:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1sD (D:)
    slqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvps
    rpvrlp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u1sE (E:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1sE (E:)
    ghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psrpvr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u1sF (F:)
    mskghslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhais
    tvvpsrpvrlpsgdqpaepgna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1sF (F:)
    hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvvp
    srpvr