PDB entry 1u1p

View 1u1p on RCSB PDB site
Description: Crystal Structure of UP1 Complexed With d(TTAGGGTTA 2PR GG); A Human Telomeric Repeat Containing 2-aminopurine
Class: transport protein/DNA
Keywords: protein-DNA complex, UP1, human telomeric repeat, hTR, TR2-G(10)2PR, RRM, RNA Recognition Motif, 2PR, 2-aminopurine, hnRNP A1, TRANSPORT PROTEIN/DNA COMPLEX
Deposited on 2004-07-15, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.237
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1pa1, d1u1pa2
  • Chain 'B':
    Compound: 5'-d(*t*tp*ap*gp*gp*gp*tp*tp*ap*(2pr)p*gp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1pA (A:)
    msksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfv
    tyatveevdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehh
    lrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrka
    lskqemasasssqrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1pA (A:)
    kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
    vdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfeq
    ygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkalskqema
    sas
    

  • Chain 'B':
    No sequence available.