PDB entry 1u1o

View 1u1o on RCSB PDB site
Description: Crystal Structure of UP1 Complexed With d(TTAGGGTTAG(DI)G); A Human Telomeric Repeat Containing Inosine
Class: transport protein/DNA
Keywords: protein-DNA complex, UP1, human telomeric repeat, hTR, TR2-G(11)DI, RRM, RNA Recognition Motif, DI, inosine, hnRNP A1, TRANSPORT PROTEIN/DNA COMPLEX
Deposited on 2004-07-15, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1oa1, d1u1oa2
  • Chain 'B':
    Compound: 5'-d(*tp*ap*gp*gp*gp*tp*tp*ap*gp*(oip)*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1oA (A:)
    msksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfv
    tyatveevdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehh
    lrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrka
    lskqemasasssqrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1oA (A:)
    kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
    vdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfeq
    ygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkalskqema
    sas
    

  • Chain 'B':
    No sequence available.