PDB entry 1u1m

View 1u1m on RCSB PDB site
Description: Crystal Structure of UP1 Complexed With d(TTAGGGTTA 7GU GG); A Human Telomeric Repeat Containing 7-deaza-guanine
Class: transport protein/DNA
Keywords: protein-DNA complex, UP1, human telomeric repeat, hTR, TR2-G(10)7GU, RRM, RNA Recognition Motif, 7GU, 7-deaza-guanine, hnRNP A1, TRANSPORT PROTEIN/DNA COMPLEX
Deposited on 2004-07-15, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.241
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein a1
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRPA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1ma1, d1u1ma2
  • Chain 'B':
    Compound: 5'-d(*tp*ap*gp*gp*gp*tp*tp*ap*(7gu)p*gp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1mA (A:)
    msksespkepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfv
    tyatveevdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehh
    lrdyfeqygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrka
    lskqemasasssqrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1mA (A:)
    kepeqlrklfigglsfettdeslrshfeqwgtltdcvvmrdpntkrsrgfgfvtyatvee
    vdaamnarphkvdgrvvepkravsredsqrpgahltvkkifvggikedteehhlrdyfeq
    ygkievieimtdrgsgkkrgfafvtfddhdsvdkiviqkyhtvnghncevrkalskqema
    sas
    

  • Chain 'B':
    No sequence available.