PDB entry 1u1i

View 1u1i on RCSB PDB site
Description: Myo-inositol phosphate synthase mIPS from A. fulgidus
Class: isomerase
Keywords: NAD cofactor, metal ions, ISOMERASE
Deposited on 2004-07-15, released 2004-08-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myo-inositol-1-phosphate synthase
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u1ia1, d1u1ia2
  • Chain 'B':
    Compound: myo-inositol-1-phosphate synthase
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u1ib1, d1u1ib2
  • Chain 'C':
    Compound: myo-inositol-1-phosphate synthase
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u1ic1, d1u1ic2
  • Chain 'D':
    Compound: myo-inositol-1-phosphate synthase
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1u1id1, d1u1id2
  • Heterogens: PO4, K, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1iA (A:)
    mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
    lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
    lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
    asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgktgetlvkttlapm
    fayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlgyspysiteiqyfp
    slvdnktafdfvhfkgflgklmkfyfiwdaidaivaaplildiarfllfakkkgvkgvvk
    emafffkspmdtnvintheqfvvlkewysnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1iB (B:)
    mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
    lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
    lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
    asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgktgetlvkttlapm
    fayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlgyspysiteiqyfp
    slvdnktafdfvhfkgflgklmkfyfiwdaidaivaaplildiarfllfakkkgvkgvvk
    emafffkspmdtnvintheqfvvlkewysnlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1iC (C:)
    mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
    lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
    lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
    asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgktgetlvkttlapm
    fayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlgyspysiteiqyfp
    slvdnktafdfvhfkgflgklmkfyfiwdaidaivaaplildiarfllfakkkgvkgvvk
    emafffkspmdtnvintheqfvvlkewysnlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1iD (D:)
    mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
    lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
    lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
    asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgktgetlvkttlapm
    fayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlgyspysiteiqyfp
    slvdnktafdfvhfkgflgklmkfyfiwdaidaivaaplildiarfllfakkkgvkgvvk
    emafffkspmdtnvintheqfvvlkewysnlk