PDB entry 1u1i

View 1u1i on RCSB PDB site
Description: myo-inositol phosphate synthase mips from a. fulgidus
Deposited on 2004-07-15, released 2004-08-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1iA (A:)
    mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
    lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
    lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
    asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgktgetlvkttlapm
    fayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlgyspysiteiqyfp
    slvdnktafdfvhfkgflgklmkfyfiwdaidaivaaplildiarfllfakkkgvkgvvk
    emafffkspmdtnvintheqfvvlkewysnlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1iB (B:)
    mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
    lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
    lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
    asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgktgetlvkttlapm
    fayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlgyspysiteiqyfp
    slvdnktafdfvhfkgflgklmkfyfiwdaidaivaaplildiarfllfakkkgvkgvvk
    emafffkspmdtnvintheqfvvlkewysnlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1iC (C:)
    mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
    lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
    lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
    asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgktgetlvkttlapm
    fayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlgyspysiteiqyfp
    slvdnktafdfvhfkgflgklmkfyfiwdaidaivaaplildiarfllfakkkgvkgvvk
    emafffkspmdtnvintheqfvvlkewysnlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u1iD (D:)
    mkvwlvgaygivsttamvgaraiergiapkiglvselphfegiekyapfsfefggheirl
    lsnayeaakehwelnrhfdreileavksdlegivarkgtalncgsgikelgdiktlegeg
    lslaemvsrieediksfaddetvvinvasteplpnyseeyhgslegfermidedrkeyas
    asmlyayaalklglpyanftpspgsaipalkelaekkgvphagndgktgetlvkttlapm
    fayrnmevvgwmsynilgdydgkvlsardnkeskvlskdkvlekmlgyspysiteiqyfp
    slvdnktafdfvhfkgflgklmkfyfiwdaidaivaaplildiarfllfakkkgvkgvvk
    emafffkspmdtnvintheqfvvlkewysnlk