PDB entry 1u1h

View 1u1h on RCSB PDB site
Description: A. thaliana cobalamine independent methionine synthase
Deposited on 2004-07-15, released 2004-09-02
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-02, with a file datestamp of 2004-09-02.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1hA (A:)
    mashivgyprmgpkrelkfalesfwdgkstaedlqkvsadlrssiwkqmsaagtkfipsn
    tfahydqvldttamlgavpprygytggeigldvyfsmargnasvpamemtkwfdtnyhyi
    vpelgpevnfsyashkavneykeakalgvdtvpvlvgpvsylllskaakgvdksfellsl
    lpkilpiykevitelkaagatwiqldepvlvmdlegqklqaftgayaelestlsglnvlv
    etyfadipaeayktltslkgvtafgfdlvrgtktldlvkagfpegkylfagvvdgrniwa
    ndfaaslstlqalegivgkdklvvstscsllhtavdlinetklddeikswmafaaqkvve
    vnalakalagqkdealfsanaaalasrrssprvtnegvqkaaaalkgsdhrratnvsarl
    daqqkklnlpilptttigsfpqtvelrrvrreykakkvseedyvkaikeeikkvvdlqee
    ldidvlvhgeperndmveyfgeqlsgfaftangwvqsygsrcvkppviygdvsrpkamtv
    fwsamaqsmtsrpmkgmltgpvtilnwsfvrndqprhetcyqialaikdevedlekggig
    viqideaalreglplrksehafyldwavhsfritncgvqdstqihthmcyshfndiihsi
    idmdadvitiensrsdekllsvfregvkygagigpgvydihspripsseeiadrvnkmla
    vleqnilwvnpdcglktrkytevkpalknmvdaaklirsqlasak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1hA (A:)
    ashivgyprmgpkrelkfalesfwdgkstaedlqkvsadlrssiwkqmsaagtkfipsnt
    fahydqvldttamlgavpprygytggeigldvyfsmargnasvpamemtkwfdtnyhyiv
    pelgpevnfsyashkavneykeakalgvdtvpvlvgpvsylllskaakgvdksfellsll
    pkilpiykevitelkaagatwiqldepvlvmdlegqklqaftgayaelestlsglnvlve
    tyfadipaeayktltslkgvtafgfdlvrgtktldlvkagfpegkylfagvvdgrniwan
    dfaaslstlqalegivgkdklvvstscsllhtavdlinetklddeikswmafaaqkvvev
    nalakalagqkdealfsanaaalasrrssprvtnegvqkaaaalkgsdhrratnvsarld
    aqqkklnlpilptttigsfpqtvelredyvkaikeeikkvvdlqeeldidvlvhgepern
    dmveyfgeqlsgfaftangwvqsygsrcvkppviygdvsrpkamtvfwsamaqsmtsrpm
    kgmltgpvtilnwsfvrndqprhetcyqialaikdevedlekggigviqideaalreglp
    lrksehafyldwavhsfritncgvqdstqihthmcyshfndiihsiidmdadvitiensr
    sdekllsvfregvkygagigpgvydihspripsseeiadrvnkmlavleqnilwvnpdcg
    lktrkytevkpalknmvdaaklirsq