PDB entry 1u1g

View 1u1g on RCSB PDB site
Description: Structure of E. coli uridine phosphorylase complexed to 5-(m-(benzyloxy)benzyl)barbituric acid (BBBA)
Class: transferase
Keywords: PYRIMIDINE NUCLEOSIDE PHOSPHORYLASE; URIDINE SALVAGE; UDP; 5-(m-(BENZYLOXY)BENZYL)ACYCLOURIDINE; BBBA, TRANSFERASE
Deposited on 2004-07-15, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.201
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1ga_
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1gb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1gc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1gd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1ge_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1gf_
  • Heterogens: K, BBB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1gA (A:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1gA (A:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqaetmkqteshavkivvea
    arrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u1gB (B:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1gB (B:)
    ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
    kivveaarrll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u1gC (C:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1gC (C:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u1gD (D:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1gD (D:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u1gE (E:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1gE (E:)
    ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqnaetmkqteshavkivv
    eaarrll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u1gF (F:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1gF (F:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll