PDB entry 1u1d

View 1u1d on RCSB PDB site
Description: Structure of e. coli uridine phosphorylase complexed to 5-(phenylthio)acyclouridine (ptau)
Class: transferase
Keywords: pyrimidine nucleoside phosphorylase; uridine salvage; ptau; 5-(phenylthio)acyclouridine, transferase
Deposited on 2004-07-15, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.211
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12758 (4-255)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1u1da2, d1u1da3
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1db_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1dc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1dd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1de_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1df_
  • Heterogens: PO4, K, 181, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1dA (A:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1dA (A:)
    msksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgk
    pvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u1dB (B:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1dB (B:)
    ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
    kivveaarrll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u1dC (C:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1dC (C:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u1dD (D:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1dD (D:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u1dE (E:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1dE (E:)
    ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
    kivveaarrll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u1dF (F:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1dF (F:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll