PDB entry 1u1c

View 1u1c on RCSB PDB site
Description: Structure of E. coli uridine phosphorylase complexed to 5-benzylacyclouridine (BAU)
Class: transferase
Keywords: PYRIMIDINE NUCLEOSIDE PHOSPHORYLASE; URIDINE SALVAGE; benzylacyclouridine; BAU, TRANSFERASE
Deposited on 2004-07-15, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12758 (4-255)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1u1ca2, d1u1ca3
  • Chain 'B':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1cb_
  • Chain 'C':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1cc_
  • Chain 'D':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1cd_
  • Chain 'E':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1ce_
  • Chain 'F':
    Compound: Uridine phosphorylase
    Species: Escherichia coli [TaxId:562]
    Gene: UDP, B3831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u1cf_
  • Heterogens: PO4, K, BAU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u1cA (A:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1cA (A:)
    msksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgk
    pvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
    lhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhf
    kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
    avkivveaarrll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u1cB (B:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1cB (B:)
    ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
    kivveaarrll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1u1cC (C:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1cC (C:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1u1cD (D:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1cD (D:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqmkqteshavkivveaarr
    ll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1u1cE (E:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1cE (E:)
    ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
    ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
    faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
    smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
    kivveaarrll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1u1cF (F:)
    gshmsksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwrael
    dgkpvivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrld
    gaslhfaplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvv
    rhfkgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqt
    eshavkivveaarrll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u1cF (F:)
    sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
    vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
    aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
    meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
    ivveaarrll