PDB entry 1u1b

View 1u1b on RCSB PDB site
Description: Structure of bovine pancreatic Ribonuclease A in complex with 3'-phosphothymidine (3'-5')-pyrophosphate adenosine 3'-phosphate
Class: hydrolase
Keywords: hydrolase, ribonuclease, endonuclease, nucleotide inhibitor
Deposited on 2004-07-15, released 2005-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease, pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNASE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u1ba_
  • Chain 'B':
    Compound: Ribonuclease, pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene: RNASE1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1u1bb_
  • Heterogens: PAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1u1bA (A:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1u1bB (B:)
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv