PDB entry 1u19

View 1u19 on RCSB PDB site
Description: Crystal Structure of Bovine Rhodopsin at 2.2 Angstroms Resolution
Class: signaling protein
Keywords: g protein-coupled receptor, membrane protein, retinal protein, photoreceptor, signaling protein
Deposited on 2004-07-15, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-03-25, with a file datestamp of 2015-03-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhodopsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u19a_
  • Chain 'B':
    Compound: rhodopsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1u19b_
  • Heterogens: HG, ZN, RET, PLM, HTO, HTG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u19A (A:)
    mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
    vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
    geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
    egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
    attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
    ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1u19B (B:)
    mngtegpnfyvpfsnktgvvrspfeapqyylaepwqfsmlaaymfllimlgfpinfltly
    vtvqhkklrtplnyillnlavadlfmvfggftttlytslhgyfvfgptgcnlegffatlg
    geialwslvvlaieryvvvckpmsnfrfgenhaimgvaftwvmalacaapplvgwsryip
    egmqcscgidyytpheetnnesfviymfvvhfiipliviffcygqlvftvkeaaaqqqes
    attqkaekevtrmviimviaflicwlpyagvafyifthqgsdfgpifmtipaffaktsav
    ynpviyimmnkqfrncmvttlccgknplgddeasttvsktetsqvapa