PDB entry 1u18

View 1u18 on RCSB PDB site
Description: 1.96 A Crystal structure of H60C mutant of nitrophorin complexed with histamine
Class: signaling protein
Keywords: lipocalin, beta barrel, ferric heme, SIGNALING PROTEIN
Deposited on 2004-07-15, released 2005-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.187
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrophorin 1
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26239 (1-184)
      • conflict (59)
    Domains in SCOPe 2.07: d1u18a_
  • Chain 'B':
    Compound: nitrophorin 1
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26239 (1-184)
      • conflict (59)
    Domains in SCOPe 2.07: d1u18b_
  • Heterogens: PO4, HEM, HSM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u18A (A:)
    mkctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyc
    ydpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssali
    htclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslk
    slltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u18A (A:)
    kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealycy
    dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
    lltk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1u18B (B:)
    mkctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyc
    ydpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssali
    htclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslk
    slltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u18B (B:)
    kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealycy
    dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
    tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
    lltk