PDB entry 1u16

View 1u16 on RCSB PDB site
Description: Crystal structure of a duck-delta-crystallin-1 double loop mutant (DLM) in complex with sulfate
Class: lyase
Keywords: eye lens protein, duck-delta-crystallin, argininosuccinate lyase, enzyme mechanism, LYASE
Deposited on 2004-07-14, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta crystallin I
    Species: Anas platyrhynchos [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24057
      • engineered (21-22)
      • engineered (24-25)
      • engineered (28-30)
      • engineered (73)
      • engineered (78)
      • engineered (81)
      • engineered (88)
    Domains in SCOPe 2.07: d1u16a_
  • Heterogens: SO4, CL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1u16A (A:)
    masegdklmggrfvgstdpimeklnssiaydqrlsevdiqasiayakalekagiltktel
    ekilsglekiseewskgvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtd
    lklfmknslsiisthllqliktlveraaieidvilpgythlqkaqpirwsqfllshaval
    trdserlgevkkrinvlplgsgalagnpldidremlrselefasislnsmdaiserdfvv
    eflsvatlllihlskmaedliiystsefgfltlsdafstgsslmpqkknpdslelirska
    grvfgrlasilmvlkglpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenm
    ekaltpemlatdlalylvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplf
    ssdvsqvfnfvnsveqytalggtakssvttqieqlrelmkkqkeqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1u16A (A:)
    stdpimeklnssiaydqrlsevdiqasiayakalekagiltktelekilsglekiseews
    kgvfvvkqsdedihtanerrlkeligdiagklhtgrsrneqvvtdlklfmknslsiisth
    llqliktlveraaieidvilpgythlqkaqpirwsqfllshavaltrdserlgevkkrin
    vlplgsgalagnpldidremlrselefasislnsmdaiserdfvveflsvatlllihlsk
    maedliiystsefgfltlsdafstgsslmpqkknpdslelirskagrvfgrlasilmvlk
    glpstynkdlqedkeavidvvdtltavlqvatgvistlqiskenmekaltpemlatdlal
    ylvrkgmpfrqahtasgkavhlaetkgiainnltledlksisplfssdvsqvfnfvnsve
    qytalggtakssvttqieqlrelmkkqke